PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0637
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 1040aa    MW: 115688 Da    PI: 7.8502
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0637genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.72.2e-40157234178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C+adls+ak+yhrrhkvC+vhska+++lv + +qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Gh_D02G0637 157 VCQVEDCRADLSKAKDYHRRHKVCDVHSKATKALVGNAMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 234
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.949155232IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.0E-31155219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-37156236IPR004333Transcription factor, SBP-box
PfamPF031102.1E-28158231IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.95E-7806937IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.7E-6808934IPR020683Ankyrin repeat-containing domain
CDDcd002043.59E-7810921No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1040 aa     Download sequence    Send to blast
MEGKFGGKPR HFYGPTASDL KAAEKKSVEW DLNDWKWDGD LFTATPLNPV PSDCRSRRLF  60
PDGPETAPNA GSSHSSSSCS EHSSPGNEKG KRKMQNKKRA VVVLDDDDDN DDDDDDGVKG  120
DAGSLKLQLG GQVYPIMDED AKCGKKTKVT GTPCRAVCQV EDCRADLSKA KDYHRRHKVC  180
DVHSKATKAL VGNAMQRFCQ QCSRFHVLQE FDEGKRSCRR RLAGHNRRRR KTHPDNLPTA  240
NSLNDERNSS FLLISLLRIL SSMHSNNSDQ AKDQDLVAHL LRSLANVACS TNGRNLSGFL  300
QGFHGAANAG RSLGNLEKPT DVVSGSTEHV RPSGSASKID DCANLAEWQG AMGYCGTVPT  360
SDLAHRRANN DAQDGILSGS PSRTLIWSGA GFQPRASETG DTVERIRIDK IDLNNVYDDS  420
QDYVENLERS LVLKNPVNGS LHSSVGVPES LKSSPPQLSK NSDLTPSQSP STSGGEAQSR  480
TDRIVFKLFG KNPNDFPIAL RRQILEWLSH SPADIESYIR PGCIILTIYL RLRESAWEEL  540
CYDLGSSLRK LVDVSNDSFW KTGWVYARVQ HSVAFIYNGR VVLDAPLPLK SHRNCKISSI  600
KPIAVSVTER AQFVVKGFNL NQSSTRLLCA VEGKYLVQET CYDLMDAVDP INEQDKLQHL  660
CFLCSIPNVS GRGFIEVEDF GLSSTFFPFI VAEQEVCSEI CTLEGVIETA VPTVDINKKE  720
EKMEIRNQAL DFIHEMGWLL HRNHLNRKLG DVNPNLNLFP FRRFKWLMEF SMDHDWCAVV  780
KKLLGILFDG TVDLGDHSSM EFALLDMCLL HKAVRRNCRP MVELLLRYVP NEVLDKPGSK  840
QKLSVDGNDY GFMFKPNVVG PAGLTPLHMV ASREGCENVL DALTDDPGLV AIEAWKSAQD  900
STGLTPNDYA RLQGHYSYIH LVQRKINKKS ECGYIVLDIP GTPLDCNSKQ KLSDGTRSAM  960
AVSLEIQKIK KKARQDGCKA CEKKLAYGNR RTSLVYRPTM LSMVAIAAVC VCVALLFKSS  1020
PEVLYVFRPF RWELLKYGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291572311084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223090.0KJ622309.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482280.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_012482281.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
TrEMBLA0A0D2RGS70.0A0A0D2RGS7_G
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1